PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00002g00037.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 105aa    MW: 12037.1 Da    PI: 9.9698
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00002g00037.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.52.3e-161461148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                              +g+WT+eEd++l+  +   G  +W+++++  g++R++k+c++rw +yl
  Peaxi162Scf00002g00037.1 14 KGPWTAEEDKKLISFILTNGQCCWRAVPKLAGLRRCGKSCRLRWTNYL 61
                              79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.6E-22562IPR009057Homeodomain-like
PROSITE profilePS5129420.113965IPR017930Myb domain
SMARTSM007171.5E-121363IPR001005SANT/Myb domain
PfamPF002491.9E-151461IPR001005SANT/Myb domain
SuperFamilySSF466899.9E-191588IPR009057Homeodomain-like
CDDcd001672.65E-91661No hitNo description
PROSITE profilePS500903.92662105IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.609.1E-66389IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 105 aa     Download sequence    Send to blast
MGRQPCCDKL GVKKGPWTAE EDKKLISFIL TNGQCCWRAV PKLAGLRRCG KSCRLRWTNY  60
LRPDLKRGLL SDAEEKLVID LHSRLGNRSY DRVVQDCCKI TRKDG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-151488477MYB PROTO-ONCOGENE PROTEIN
1mse_C3e-151488477C-Myb DNA-Binding Domain
1msf_C3e-151488477C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF7939151e-146JF793915.1 Petunia axillaris isolate N MYB transcription factor ODO1 (ODO1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009628634.13e-57PREDICTED: protein ODORANT1-like
RefseqXP_016455416.13e-57PREDICTED: protein ODORANT1-like
SwissprotQ50EX61e-60ODO1_PETHY; Protein ODORANT1
TrEMBLF5CSR94e-59F5CSR9_9SOLA; MYB transcription factor ODO1
TrEMBLF5CSR74e-59F5CSR7_9SOLA; MYB transcription factor ODO1
TrEMBLF5CSR85e-59F5CSR8_9SOLA; MYB transcription factor ODO1
STRINGPGSC0003DMT4000122031e-56(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12350.13e-57myb domain protein 42